Skip to main content

H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-ME

For more information call 1-800-282-3982 or email info@parchem.com!

Inquire with a Quick Quote

Product Description

PRODUCT

H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-ME

CAS #

122613-29-0

SYNONYM

PKC (530-558); PKC FRAGMENT (530-558); PROTEIN KINASE C (530-558); PROTEIN KINASE C FRAGMENT 530-558; LLYEMLAGQAPFEGEDEDELFQSIMEHNV; LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2; H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2; H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2

FORMULA

C148H221N35O50S2

Product Specifications

MOLECULAR WEIGHT

3,354.67

FUNCTIONS

For more information call 1-800-282-3982 or email info@parchem.com!

Looking for another product? Get a quick quote now!

Enter a chemical name, synonym or CAS# below to search